PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco021382.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ARF
Protein Properties Length: 652aa    MW: 72559.7 Da    PI: 9.9478
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco021382.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.31.7e-24143244199
                  EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                  f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW  Fv+ ++L +gD v+F   +++++el
  Aco021382.1 143 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWTAFVNKKKLVSGDAVLFL--RSHSGEL 237
                  99****************************963.3445679************************************************..4479999 PP

                  EEEEE-S CS
           B3  93 vvkvfrk 99 
                  +++++r+
  Aco021382.1 238 RLGIRRA 244
                  ****996 PP

2Auxin_resp125.73e-41269350182
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                  +a+a+s+ksvF+++YnPras+seF+v+++k+ k++++++++GmRfkm++e+ed++err++G+++g+sd+dp+rWp+SkWr+L
  Aco021382.1 269 VASAVSMKSVFHIYYNPRASPSEFIVPYWKFTKSFSHPFAIGMRFKMRYESEDAAERRYTGLITGISDVDPIRWPGSKWRCL 350
                  6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-44130259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-40136248IPR015300DNA-binding pseudobarrel domain
CDDcd100179.68E-22141243No hitNo description
SMARTSM010191.4E-22143245IPR003340B3 DNA binding domain
PROSITE profilePS5086313.155143245IPR003340B3 DNA binding domain
PfamPF023622.2E-22143244IPR003340B3 DNA binding domain
PfamPF065071.0E-35270350IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
RNGIDLNRWR RRRRRRRRRR RGAAGRCASS CGTRARGRDI VARRGAWSCT CPRALEHAGD  60
GGAAPRGARS LRRAPHVFCR VVDVKLMSVS FVAEALTDEV YAQLSLVAET EEVEQRIHEA  120
GVEGDGEMED DDTEKRSSMP HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP PLDYKQQRPS  180
QELVAKDLHG TEWRFRHIYR GQPRRHLLTT GWTAFVNKKK LVSGDAVLFL RSHSGELRLG  240
IRRAVQLKTG APFQALHNQN SCISTLATVA SAVSMKSVFH IYYNPRASPS EFIVPYWKFT  300
KSFSHPFAIG MRFKMRYESE DAAERRYTGL ITGISDVDPI RWPGSKWRCL LVHVRWDEDV  360
DISRQNRVSP WEIEPTGSIS GSHGLSPSSS KRAKMSLPTV NSEFPVPNGS GSTDLGESSR  420
FHKVLQGQEI LGFRTLRDGM DVSRNTQYPY ALSGSRSGAG NPVGISGFPH HCAGFGESFR  480
FQKVLQGQEL FPHHRGTLVD ASTRNSGFGS SAALNRWPGQ AQGYASFAQS SNPPTQASSP  540
SSVLMFQPTN TVIPLIQTVH RQWDKGDCIN ERFEMGNVYT RYIAKPGLNN RDVSRNGCKL  600
FGFSLTERIP VTDEGDSGEV NCETEFQASR PSLERNCTAE RALYALCAAP L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A3e-937738273361Auxin response factor 1
4ldy_B3e-937738273361Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11020RRRRRRRRRRR
21220RRRRRRRRR
31320RRRRRRRR
41420RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798269.10.0PREDICTED: auxin response factor 15-like isoform X3
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLM0SJE90.0M0SJE9_MUSAM; Auxin response factor
STRINGGSMUA_Achr3P31350_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-152ARF family protein